missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CIITA Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
2885.00 DKK - 4530.00 DKK
Specifications
Antigen | CIITA |
---|---|
Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
Applications | Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
18310596
|
Bio-Techne
NBP3-17818-25UL |
25 μg |
2885.00 DKK
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
18333554
|
Bio-Techne
NBP3-17818-100UL |
100 μg |
4530.00 DKK
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CIITA Polyclonal antibody specifically detects CIITA in Human samples. It is validated for ImmunofluorescenceSpecifications
CIITA | |
Immunofluorescence | |
Unconjugated | |
Rabbit | |
Immunology | |
PBS, pH 7.2, 40% glycerol | |
4261 | |
IgG | |
Affinity purified |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
C2TA, C2TAMHC class II transactivator type III, CIITAIV, class II, major histocompatibility complex, transactivator, MHC class II transactivator, MHC2TANLR family, acid domain containing, NLRA, nucleotide-binding oligomerization domain, leucine rich repeat and acid domaincontaining | |
This antibody was developed against Recombinant Protein corresponding to amino acids: PEGPIQFVPTISTLPHGLWQISEAGTGVSSIFIYHGEVPQASQVPPPSGFTVHGLPTSPDRPGSTSPFAPSATDLPSMPEPALT | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title