missing translation for 'onlineSavingsMsg'
Learn More

GMPS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP1-52972

Product Code. 18292375

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

GMPS Polyclonal specifically detects GMPS in Human samples. It is validated for Western Blot.

Specifications

Antigen	GMPS
Classification	Polyclonal
Conjugate	Unconjugated
Formulation	PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias	EC 6.3.5.2, Glutamine amidotransferase, GMP synthase, GMP synthase [glutamine-hydrolyzing], GMP synthetase, guanine monphosphate synthetase, guanosine 5'-monophosphate synthase, MLL/GMPS fusion protein
Host Species	Rabbit
Molecular Weight of Antigen	77 kDa
Quantity	100 μL
Research Discipline	metabolism
Gene ID (Entrez)	8833
Reconstitution	Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Applications	Western Blot
Concentration	0.5 mg/ml
Dilution	Western Blot 1.0 ug/ml
Gene Accession No.	P49915
Gene Symbols	GMPS
Immunogen	Synthetic peptides corresponding to GMPS(guanine monphosphate synthetase) The peptide sequence was selected from the middle region of GMPS. Peptide sequence VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA.
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Test Specificity	Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Guinea pig: 92%; Zebrafish: 92%.
Target Species	Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype	IgG

Product Suggestions

Description