Learn More
Invitrogen™ Human CLEC4E (aa 90-204) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP88577
1317.39 DKK valid until 2025-03-29
Use promo code "24111" to get your promotional price.
Alert:
To receive the discount customers must purchase three of the same product at list price in a single order to receive 33.33% discount. There is no limit to the multiples of 3 that customers can buy. Use promo code ”24111” to get your promotional price
Description
Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52135 (PA5-52135. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CLEC4E encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.
Specifications
Q9ULY5 | |
Blocking Assay, Control | |
26253 | |
100 μL | |
C86253; CLEC4E; CLECSF9; C-type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 9; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 9; C-type lectin domain family 4 member E; C-type lectin domain family 4, member E; C-type lectin superfamily member 9; C-type lectin, superfamily member 9; immunoreceptor; macrophage-inducible C-type lectin; Mincle; UNQ218/PRO244 | |
CLEC4E | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CLEC4E (aa 90-204) Control Fragment | |
RUO | |
CLEC4E | |
Unconjugated | |
Recombinant | |
SCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRI | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.