missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CTPS (aa 539-591) Control Fragment Recombinant Protein

Recombinant Protein

Brand:  Invitrogen™ RP104921

Product Code. 30199355

  • 2020.00 DKK / 100µL

Please to purchase this item. Need a web account? Register with us today!

Explore more special offers
This item is not returnable. View return policy

Description

Description

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65655 (PA5-65655. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

There are two genes encoding members of a new family of type II integral membrane proteins. Both are ubiquitously expressed, and tissue-specific alternative mRNA initiation and splicing generate at least two major isoforms of each protein, with the smaller isoforms being truncated at the N-terminus. These proteins are called nesprin-l and -2 for nuclear _envelope _spectrin repeat, as they are characterized by the presence of multiple, clustered spectrin repeats, bipartite nuclear localization sequences and a conserved C-terminal, single transmembrane domain. Transient transfection of EGFP-fusion expression constructs demonstrated their localization to the nuclear membrane with a novel C-terminal, TM-domain-containing sequence essential for perinuclear localization. Nesprin-l is developmentally regulated in both smooth and skeletal muscle and is relocalized from the nuclear envelope to the nucleus and cytoplasm during C2Cl2 myoblast differentiation. Nesprins may function as 'dystrophins of the nucleus' to maintain nuclear organization and structura integrity.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

P17812
Blocking Assay, Control
1503
100 ÎĽL
cb1040; CTP synthase; CTP synthase 1; CTP synthase 1 A; CTP synthase a; CTP synthetase 1; CTPS; ctps1; ctps1a; ctpsa; cytidine 5-prime triphosphate synthetase; cytidine 5'-triphosphate synthase; cytidine 5'-triphosphate synthetase; IMD24; UTP--ammonia ligase 1; wu:fb49e03; wu:fe17b03
CTPS1
Human
His-ABP-tag
-20°C, Avoid Freeze/Thaw Cycles
Liquid
≥5.0 mg/mL
1 M urea, PBS with no preservative; pH 7.4
Human CTPS (aa 539-591) Control Fragment
RUO
CTPS
Unconjugated
Recombinant
PYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
E. coli
>80% by SDS-PAGE and Coomassie blue staining
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Invitrogen™ Human CTPS (aa 539-591) Control Fragment Recombinant Protein > 100 ÎĽL; Unlabeled

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.