Learn More
Invitrogen™ Human CTPS2 (aa 252-302) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP109515
Description
Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene catalyzes the formation of CTP from UTP with the concomitant deamination of glutamine to glutamate. This protein is the rate-limiting enzyme in the synthesis of cytosine nucleotides, which play an important role in various metabolic processes and provide the precursors necessary for the synthesis of RNA and DNA. Cancer cells that exhibit increased cell proliferation also exhibit an increased activity of this encoded protein. Thus, this protein is an attractive target for selective chemotherapy. Alternative splicing results in multiple transcript variants.
Specifications
Q9NRF8 | |
Blocking Assay, Control | |
56474 | |
100 ÎĽL | |
A830031M15Rik; AI326475; CTP synthase 2; CTP synthase II; CTP synthetase 2; CTP synthetase homolog; CTP synthetase type 2; CTPS2; CTPsH; cytidine 5'-triphosphate synthase 2; cytidine 5'-triphosphate synthetase 2; cytidine triphosphate synthase II; UTP-ammonia ligase 2; UTP--ammonia ligase 2 | |
Ctps2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CTPS2 (aa 252-302) Control Fragment | |
RUO | |
CTPS2 | |
Unconjugated | |
Recombinant | |
RVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIA | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.