missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human FNDC1 (aa 1535-1633) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP104190
This item is not returnable.
View return policy
Description
Specifications
Q4ZHG4 | |
Blocking Assay, Control | |
84624 | |
100 μL | |
RUO | |
FNDC1 | |
Human | |
ECYAEEDEFSGLETDTAVPTEEAYVIYDEDYEFETSRPPTTTEPSTTATTPRVIPEEGAISSFPEEEFDLAGRKRFVAPYVTYLNKDPSAPCSLTDALD | |
Liquid |
≥5.0 mg/mL | |
1M urea, PBS with no preservative; pH 7.4 | |
FNDC1 | |
-20° C, Avoid Freeze/Thaw Cycles | |
1110027O12Rik; 1110051A18Rik; Activation-associated cDNA protein; activator of G-protein signaling 8; AGS8; bA243O10.1; dJ322A24.1; expressed in synovial lining protein; fibronectin type III domain containing 1; fibronectin type III domain containing 2; fibronectin type III domain-containing protein 1; FNDC1; FNDC2; KIAA1866; MEL4B3; mKIAA1866 | |
Unconjugated | |
Recombinant | |
E. coli |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction