Learn More
Invitrogen™ Human HAL (aa 79-177) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP97640
Description
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58434 (PA5-58434. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
HAL is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. HAL defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids Histidine ammonia-lyase is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. Histidine ammonia-lyase defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids.
Specifications
P42357 | |
Blocking Assay, Control | |
3034 | |
100 ÎĽL | |
hal; HIS; histidase; histidine ammonia lyase; histidine ammonia-lyase; histidinemia; Hsd; HSTD; Huth; zgc:136980 | |
HAL | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human HAL (aa 79-177) Control Fragment | |
RUO | |
HAL | |
Unconjugated | |
Recombinant | |
FVEVVIEGDAMSPDFIPSQPEGVYLYSKYREPEKYIELDGDRLTTEDLVNLGKGRYKIKLTPTAEKRVQKSREVIDSIIKEKTVVYGITTGFGKFARTV | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.