missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human KCNJ15 Partial ORF (NP_002234, 290 a.a. - 355 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00003772-Q01.10ug
This item is not returnable.
View return policy
Description
Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]
Sequence: TSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYSpecifications
NP_002234 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
33kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
TSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKY | |
RUO | |
KCNJ15 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
3772 | |
KCNJ15 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
IRKK/KIR1.3/KIR4.2/MGC13584 | |
KCNJ15 | |
Recombinant | |
wheat germ expression system |