Learn More
Invitrogen™ Human Lysozyme (aa 82-147) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP100897
1317.39 DKK valid until 2025-03-29
Use promo code "24111" to get your promotional price.
Alert:
To receive the discount customers must purchase three of the same product at list price in a single order to receive 33.33% discount. There is no limit to the multiples of 3 that customers can buy. Use promo code ”24111” to get your promotional price
Description
Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111271 (PA5-111271. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the anti-microbial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. Missense mutations in LYZ have been identified in heritable renal amyloidosis.
Specifications
P61626 | |
Blocking Assay, Control | |
4069 | |
100 μL | |
1,4-beta-N-acetylmuramidase C; 1700038F02Rik; 4-beta-N-acetylmuramidase C; AI326280; Allergen Gal d IV; bA534G20.1; c-type lysozyme; dystrophin; egg white lysozyme; Gal d 4; KAAG648; LYC2; Lys; Lysm; lysozyme; lysozyme (renal amyloidosis); lysozyme 1; lysozyme 2; lysozyme C; Lysozyme C type M; lysozyme C type P; Lysozyme C, spleen isozyme; lysozyme C-1; Lysozyme C-2; lysozyme C-3; lysozyme d1; lysozyme F1; lysozyme like 1; lysozyme-like 1; lysozyme-like protein 1; lysozyme-like protein 2; Lysz; LYZ; Lyz1; Lyz2; LYZC; LYZD1; LYZF1; LYZL1; Lyzs; Lzm; Lzm-s1; Lzp; Lzp-s; P lysozyme structural; PRO1278; renal amyloidosis; RGD1559869; unnamed protein product; UNQ648/PRO1278 | |
LYZ | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Lysozyme (aa 82-147) Control Fragment | |
RUO | |
Lysozyme | |
Unconjugated | |
Recombinant | |
WCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCG | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.