missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MYCBP Full-length ORF (AAH08686, 1 a.a. - 103 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
2665.00 DKK - 4040.00 DKK
Specifications
| Accession Number | AAH08686 |
|---|---|
| For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 26292 |
| Molecular Weight (g/mol) | 37.07kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16128302
|
Abnova™
H00026292-P01.10ug |
10 ug |
2665.00 DKK
10µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
16138302
|
Abnova™
H00026292-P01.25ug |
25 ug |
4040.00 DKK
25µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
The MYCBP gene encodes a protein that binds to the N-terminal region of MYC (MIM 190080) and stimulates the activation of E box-dependent transcription by MYC.[supplied by OMIM]
Sequence: MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAESpecifications
| AAH08686 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.07kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE | |
| RUO | |
| MYCBP | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 26292 | |
| MYCBP (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| AMY-1 | |
| MYCBP | |
| Recombinant | |
| wheat germ expression system |