Learn More
Invitrogen™ Human NSE2 (aa 163-241) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP104928
Description
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65676 (PA5-65676. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes the large subunit of DNA damage-binding protein which is a heterodimer composed of a large and a small subunit. This protein functions in nucleotide-excision repair. Its defective activity causes the repair defect in the patients with xeroderma pigmentosum complementation group E (XPE). However, it remains for mutation analysis to demonstrate whether the defect in XPE patients is in this gene or the gene encoding the small subunit. In addition, Best vitelliform mascular dystrophy is mapped to the same region as this gene on 11q, but no sequence alternations of this gene are demonstrated in Best disease patients.
Specifications
Q96MF7 | |
Blocking Assay, Control | |
286053 | |
100 ÎĽL | |
1110014D18Rik; AI661537; C8orf36; E3 SUMO-protein ligase NSE2; E3 SUMO-protein transferase NSE2; FLJ32440; hMMS21; methyl methanesulfonate sensitivity gene 21; MMS21; MMS21 homolog; non-SMC element 2 homolog; non-SMC element 2 homolog (MMS21, S. cerevisiae); non-SMC element 2, MMS21 homolog; non-SMC element 2, MMS21 homolog (S. cerevisiae); non-structural maintenance of chromosomes element 2 homolog; NSE2; NSE2 (MMS21) homolog, SMC5-SMC6 complex SUMO ligase; NSE2/MMS21 homolog, SMC5-SMC6 complex SUMO ligase; NSMCE2; RGD1305156; Unknown (protein for MGC:133996); zinc finger, MIZ-type containing 7; ZMIZ7 | |
Nsmce2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human NSE2 (aa 163-241) Control Fragment | |
RUO | |
NSE2 | |
Unconjugated | |
Recombinant | |
SQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKK | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.