Learn More
Invitrogen™ Human SDS (aa 82-154) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP97731
Description
Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58704 (PA5-58704. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
SDS encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor. The encoded protein can also metabolize threonine to NH4+ and 2-ketobutyrate. The encoded protein is found predominantly in the liver.
Specifications
P20132 | |
Blocking Assay, Control | |
10993 | |
100 ÎĽL | |
4432411H13Rik; L-serine ammonia-lyase; L-serine deaminase; L-serine dehydratase; L-serine dehydratase/L-threonine deaminase; L-threonine dehydratase; RATSDHE1; Sdh; SDH2; Sdhe1; SDS; serine dehydratase; TDH | |
SDS | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human SDS (aa 82-154) Control Fragment | |
RUO | |
SDS | |
Unconjugated | |
Recombinant | |
PATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.