missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SLC7A7 (aa 3-35) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP95664
This item is not returnable.
View return policy
Description
The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene.
Specifications
| Q9UM01 | |
| Blocking Assay, Control | |
| 9056 | |
| 100 μL | |
| RUO | |
| SLC7A7 | |
| Human | |
| DSTEYEVASQPEVETSPLGDGASPGPEQVKLKK | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| SLC7A7 | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| AI790233; amino acid transporter SLC7A7 y+LAT1; LAT3; LPI; monocyte amino acid permease 2; MOP-2; my+lat1; Slc7a7; solute carrier family 7 (amino acid transporter light chain, y+L system), member 7; solute carrier family 7 (cationic amino acid transporter, y+ system), member 7; solute carrier family 7 member 7; y(+)L-type amino acid transporter 1; Y+L amino acid transporter 1; Y+L amino acid transporter 1; solute carrier family 7 member 7; y+LAT1; y+LAT-1 | |
| Unconjugated | |
| Recombinant | |
| E. coli |