missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human WDR77 (aa 208-274) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP94079
This item is not returnable.
View return policy
Description
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
WDR77 is a component of the 20S PRMT5-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. This modification targets Sm proteins to the survival of motor neurons (SMN) complex for assembly into small nuclear ribonucleoprotein core particles.
Specifications
| Q9BQA1 | |
| Blocking Assay, Control | |
| 79084 | |
| 100 μL | |
| RUO | |
| WDR77 | |
| Unconjugated | |
| Recombinant | |
| CSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human WDR77 (aa 208-274) Control Fragment | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| 2610003I18Rik; 2610312E17Rik; Ac2-269; androgen receptor cofactor p44; C79984; HKMT1069; MEP50; MEP-50; Methylosome protein 50; MGC2722; Nbla10071; OTTHUMP00000013473; p44; p44/Mep50; RGD1310479; RP11-552M11.3; testis tissue sperm-binding protein Li 44 A; WD repeat domain 77; WD repeat-containing protein 77; WD45; WDR77 | |
| WDR77 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction