missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RCOR1/CoREST Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
3439.44 DKK
Specifications
| Antigen | RCOR1/CoREST |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
RCOR1/CoREST Polyclonal specifically detects RCOR1/CoREST in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RCOR1/CoREST | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Transcription Factors and Regulators | |
| PBS buffer, 2% sucrose | |
| 23186 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| KIAA0071CORESTRCORREST corepressor, Protein CoREST, REST corepressor 1 | |
| The immunogen is a synthetic peptide directed towards the middle region of human RCOR1/CoREST (NP_055971). Peptide sequence DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS | |
| Affinity purified |