missing translation for 'onlineSavingsMsg'
Learn More

CIITA Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-17818-25UL

Product Code. 18310596

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Descrizione

CIITA Polyclonal antibody specifically detects CIITA in Human samples. It is validated for Immunofluorescence

Specifica

Antigen	CIITA
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias	C2TA, C2TAMHC class II transactivator type III, CIITAIV, class II, major histocompatibility complex, transactivator, MHC class II transactivator, MHC2TANLR family, acid domain containing, NLRA, nucleotide-binding oligomerization domain, leucine rich repeat and acid domaincontaining
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: PEGPIQFVPTISTLPHGLWQISEAGTGVSSIFIYHGEVPQASQVPPPSGFTVHGLPTSPDRPGSTSPFAPSATDLPSMPEPALT
Quantity	25 μg
Research Discipline	Immunology
Gene ID (Entrez)	4261
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Suggerimenti di prodotto

Descrizione