missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FLJ20186 Recombinant Protein

Brand: Abnova™ H00054849-P01.25ug

Product Code. 16180813

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH15482
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	47.41
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	25 ug
Immunogen	MEYDEKLARFRQAHLNPFNKQSGPRQHEQGPGEEVPDVTPEEALPELPPGEPEFRCPERVMDLGLSEDHFSRPVGLFLASDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLKLQELKDPNEDEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGGPRPRRGVRNERDQSSCLRWAHIQM
Gene Alias	FLJ20186/MGC104349
Gene Symbol	DEF8
Species	Wheat Germ (in vitro)
Protein Tag	GST

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	54849
Name	FLJ20186 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	DEF8
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

Product Suggestions

Description