missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR1J1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-09388-100UL
This item is not returnable.
View return policy
Description
OR1J1 Polyclonal specifically detects OR1J1 in Mouse samples. It is validated for Western Blot.Specifications
OR1J1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
hg32, olfactory receptor 1J1, Olfactory receptor OR9-18, olfactory receptor, family 1, subfamily J, member 1, OR9-18 | |
The immunogen is a synthetic peptide directed towards the middle region of Mouse OR1J1 (NP_996786). Peptide sequence LGALLKLSCSDTSLNQLVIFTAGLAAIMLPFLCILISYGRIGFTILQVPT | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
347168 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction