missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR1J1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
3500.00 DKK
Specifications
Antigen | OR1J1 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
OR1J1 Polyclonal specifically detects OR1J1 in Mouse samples. It is validated for Western Blot.Specifications
OR1J1 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Mouse | |
hg32, olfactory receptor 1J1, Olfactory receptor OR9-18, olfactory receptor, family 1, subfamily J, member 1, OR9-18 | |
The immunogen is a synthetic peptide directed towards the middle region of Mouse OR1J1 (NP_996786). Peptide sequence LGALLKLSCSDTSLNQLVIFTAGLAAIMLPFLCILISYGRIGFTILQVPT | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
347168 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title